Gene Mb1525
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1525, -, len: 118 aa. Equivalent to Rv1489, len: 118 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 118 aa overlap). Conserved hypothetical protein, similar to hypothetical proteins from Mycobacterium avium subsp. paratuberculosis and Streptomyces coelicolor e.g. AJ250017_1 insertion sequence IS900, Locus 3, putative invasion protein from M. paratuberculosis (138 aa), FASTA scores: opt: 120, E(): 0.26, (34.375% identity in 96 aa overlap); SCD6.11c|AL353815_11 possible integral membrane protein from Streptomyces coelicolor (136 aa), FASTA scores: opt: 106, E(): 2.2, (35.9% identity in 103 aa overlap). ORF predicted by GC plot. Replaces previous Rv1489c on other strand. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1675298 | 1675654 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1525|Mb1525
MSGLTSPKTYAVLAALQAGDAVACAIPLPPIARLLDDLDVPVSVRPVLPVVKAASAVGLLSVTRFPALARLTTAMLTLYFILAVGAHVRVRDRVVNAIPAASFLTLFALMTAKGPERT
Bibliography
No article yet recorded