Gene Mb1536c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb1536c, -, len: 63 aa. Equivalent to Rv1498A, len: 70 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 63 aa overlap). Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. from Streptomyces coelicolor, Sinorhizobium meliloti and Pseudomonas aeruginosa. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a single base transition (a-g) at the 5' start leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (63 aa versus 70 aa). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1686880 | 1687071 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1536c|Mb1536c MIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
Bibliography
No article yet recorded