Gene Mb1558
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1558, -, len: 188 aa. Equivalent to Rv1531, len: 188 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 188 aa overlap). Conserved hypothetical protein, similar to Rv0464c|MTV038.08c (190 aa), FASTA scores: E(): 4.8e-10, (30.9% identity in 175 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1716486 | 1717052 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1558|Mb1558
MTTSRVPLLPVDEAKAAADEAGVPDYMAELSIFQVLLNHPRLARTFNDLLATMLWHGTLDSRLRELVIMRIGWLTDCDYEWTQHWRVASGLGVSADDLLGVRDWQGYNGFGPAEQAVLAATDDVVREGAVSAQSWSACERELHCDKVVLIELVTVISAWRMVASILHSLEVPLEDGVSSWPPDGLSPR
Bibliography
No article yet recorded