Gene Mb1569c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hemoglobin glbn |
| Comments | Mb1569c, glbN, len: 136 aa. Equivalent to Rv1542c,len: 136 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 136 aa overlap). Probable glbN,hemoglobin. Belongs to the protozoan/cyanobacterial globin family. Similar to myoglobins e.g. GLB_PARCA|P15160 myoglobin (hemoglobin) paramecium (116 aa), FASTA scores,opt: 284, E(): 2.1e -13, (35.7% identity in 115 aa overlap). Similar to Mycobacterium tuberculosis hypothetical globin, Rv2470. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1728439 | 1728849 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1569c|glbN
MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV
Bibliography
No article yet recorded