Gene Mb1573
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1573, -, len: 143 aa. Equivalent to Rv1546, len: 143 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 143 aa overlap). Conserved hypothetical protein, similar to O05902|Rv0910|MTCY21C12.04 Hypothetical protein from Mycobacterium tuberculosis (144 aa), FASTA scores: E(): 5e-30, (37.3% identity in 142 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1731208 | 1731639 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1573|Mb1573
MASVELSADVPISPQDTWDHVSELSELGEWLVIHEGWRSELPDQLGEGVQIVGVARAMGMRNRVTWRVTKWDPPHEVAMTGSGKGGTKYGVTLTVRPTKGGSALGLRLELGGRALFGPLGSAAARAVKGDVEKSLKQFAELYG
Bibliography
No article yet recorded