Gene Mb1584
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb1584, -, len: 148 aa. Equivalent to Rv1558, len: 148 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 148 aa overlap). Conserved hypothetical protein, similar to other Mycobacterial tuberculosis proteins e.g. P71854|MTCY03C7.09c|Rv3547 (151 aa), FASTA scores opt: 330, E(): 9.1e-17, (39.7% identity in 151 aa overlap); also Q11057|Rv1261c (149 aa), and O53328|Rv3178 (119 aa). Similar also to AF072709|AF072709_5 Hypothetical protein with a new amplifiable element AUD4 from Streptomyces lividans (149 aa), FASTA scores: opt: 695,E(): 0, (69.1% identity in 149 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1749119 | 1749565 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1584|Mb1584 MPLSGEYAPSPLDWSREQADTYMKSGGTEGTQLQGKPVILLTTVGAKTGKLRKTPLMRVEHDGQYAIVASLGGAPKNPVWYHNVVKNPRVELQDGTVTGDYDAREVFGDEKAIWWQRAVAVWPDYASYQTKTDRQIPVFVLTPVRAGG
Bibliography
No article yet recorded