Gene Mb1586
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb11 |
| Comments | Mb1586, -, len: 72 aa. Equivalent to Rv1560, len: 72 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 72 aa overlap). Conserved hypothetical protein, part of a Mycobacterial tuberculosis family of proteins e.g. Q10848|Rv2009|MTCY39.08c (80 aa), FASTA score: (54.4% identity in 68 aa overlap); Q10799|Rv2871|MTCY274.02 (85 aa); O50456|Rv1241|MTV006.13 (86 aa), O06243|Rv2132|MTCY270.36C (76 aa); etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1750927 | 1751145 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1586|vapb11
MYRWCMSRTNIDIDDELAAEVMRRFGLTTKRAAVDLALRRLVGSPLSREFLLGLEGVGWEGDLDDLRSDRPD
Bibliography
No article yet recorded