Gene Mb1587
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc11 |
| Comments | Mb1587, -, len: 134 aa. Equivalent to Rv1561, len: 134 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 134 aa overlap). Conserved hypothetical protein, similar to others from Mycobacterium tuberculosis e.g. Q10847|Rv2010|MTCY39.07c (132 aa), FASTA scores: (37.0% identity in 127 aa overlap); and O06566|Rv1114|MTCY22G8.03 (124 aa). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1751151 | 1751555 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1587|vapc11
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAAGIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Bibliography
No article yet recorded