Gene Mb1590c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Maltooligosyltrehalose synthase TreYa [FIRST PART] |
| Comments | Mb1590c, treYa, len: 250 aa. Equivalent to the 5' end of Rv1563c, len: 765 aa, from Mycobacterium tuberculosis strain H37Rv, (97.4% identity in 191 aa overlap). treY (previously called glgY), maltooligosyl trehalose synthase, confirmed biochemically (see citation below). Strong similarity to Q44315|63343 TREY MALTOOLIGOSYL TREHALOSE SYNTHASE from ARTHROBACTER SP (775 aa), fasta scores: opt: 1953, E(): 0; (46.0% identity in 789 aa overlap). Some similarity to alpha-amylases and to MTCY48.03 (30.2% identity in 215 aa overlap). May catalyse conversion of maltodextrins to maltooligosyl trehaloses. Also similar to Mycobacterium tuberculosis glgB (Rv1326c),treZ (Rv1562c). REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv1563c/treY exists as a single gene. In Mycobacterium bovis, a large deletion of 806 bp splits Rv1563c in two parts, treYa and treYb. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1754046 | 1754798 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1590c|treYa
MAFPVISTYRVQMRGRSNGFGFTFADAENLLDYLDDLGVSHLYLSPILTAVGGSTHGYDVTDPTTVSPELGGSDGLARLSAAARSRGMGLIVDIVPSHVGVGKPEQNAWWWDVLKFGRSSAYAEFFDIDWELGDGRIILPLLGSDSDVANLRVDGDLLRLGDLALPVAPGSGDGTGPAVHDRQHSVWCGRRGVSSPGRHPCSVVATVHDDTVHPRHQTRRGRACPHRRAVPSAVAVGQVHRPRPSHCARP
Bibliography
No article yet recorded
