Gene Mb1593c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible inv protein |
| Comments | Mb1593c, -, len: 230 aa. Equivalent to Rv1566c,len: 230 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 230 aa overlap). Possible inv protein,probably exported as has QQAPV repeats at C-terminus. Similar to Q49634 inv protein from Mycobacterium leprae (246 aa), FASTA scores: opt: 957, E(): 0, (70.0% identity in 207 aa overlap); also to putative invasins 1,2 (O07390,O07391) from M. avium. Slightly similar to C-terminus of P60_LISMO|P21171 Listeria invasion-associated protein p60 precursor. Also similar to Mycobacterium tuberculosis p60 homologues Rv1477, Rv1478, Rv0024, Rv2190c. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1759294 | 1759986 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1593c|Mb1593c
MKRSMKSGSFAIGLAMMLAPMVAAPGLAAADPATRPVDYQQITDVVIARGLSQRGVPFSWAGGGISGPTRGTGTGINTVGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPEGTQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGTQPTPVQQAPVQPAPVQQAPVQQAPVQQAPVQQAPVQQAPVQQAPVQQAPVQPPPFGTARSR
Bibliography
No article yet recorded