Gene Mb1594c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable hypothetical membrane protein |
| Comments | Mb1594c, -, len: 94 aa. Equivalent to Rv1567c, len: 94 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 94 aa overlap). Probable membrane protein. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1760226 | 1760510 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1594c|Mb1594c
MVTMTSWPSRLFAFTDNVCPPDACPLVPFGVNYYIYPVMWGGIGAAIATAVIGPFVSMLKGWYMSFWPIISIAVITVTSIAGYAIAGFSERYWH
Bibliography
No article yet recorded