Gene Mb1600
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable phiRV1 phage related protein |
| Comments | Mb1600, -, len: 103 aa. Equivalent to Rv1574, len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 103 aa overlap). Probable phiRV1 phage related protein (see citation below); some similarity to Rv1575|MTCY441.17, E() 1.5e-06; and Rv2647|MTCY336.29c phiRV2 phage protein, E(): 3.5e-05. Belongs to phage phiRv1 proteins. Helix turn helix motif present at aa 14-35 (+3.61 SD). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1765296 | 1765607 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1600|Mb1600
MGYKPESERHSTKTDTAIGAALGISAGTYRRLKRIDNATHSDDKEIRRFAEKQMAPLVAGSPSWNARKPRSANARVVASVHRSPMPALVPWNQSRLSATLTRR
Bibliography
No article yet recorded