Gene Mb1601
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable phiRV1 phage protein |
Comments | Mb1601, -, len: 117 aa. Similar to Rv1575 and Rv1575A, len: 117 aa and 65 aa, from Mycobacterium tuberculosis strain H37Rv, (66.9% identity in 124 aa overlap). Probable phiRV1 phage protein (see citation below). Similarity in N-terminal part to Rv1574|MTCY336.30c (103 aa), FASTA score: E(): 0.00022,(44.0% identity in 50 aa overlap); and Rv2647 phiRV2 phage protein. Similarity suggests should continue as Rv1575A. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv1575 and Rv1575A exist as 2 genes with an overlap region between them. In Mycobacterium bovis, a single base deletion (c-*) and a single base insertion (*-g) lead to a single product. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1765712 | 1766065 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1601|Mb1601 MAPLAAGSPSWNGRKPSSGNRKAATMAARLDILAWGPWAQARIGASFDENRHCYRRSPRHLRRHLPAAQTNRQRNPQRVGGVGGPAPLSRGRPRLALSYLRGSLHLQNSKRVAHQHI
Bibliography
No article yet recorded