Gene Mb1604c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable phiRv1 phage protein |
Comments | Mb1604c, -, len: 156 aa. Equivalent to Rv1578c,len: 156 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 156 aa overlap). Probable phiRv1 phage protein (terminase) (see citation below), highly similar to Rv2652c|MTCY441.21c phiRV2 phage protein from M. tuberculosis, FASTA scores: E(): 4.8e-22, (48.1% identity in 156 aa overlap). Also similar to X65555|ARP3COS_1 hypothetical protein (cos site) - actinophage RP3 (210 aa), FASTA scores: opt: 373, E(): 6.5e-17, (50.0% identity in 114 aa overlap). Contains MIP family signature (PS00221). |
Functional category | Insertion seqs and phages |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1768124 | 1768594 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1604c|Mb1604c MPRPPKPARLKLVEGRSPGRDSGGRKVPESPKFIRQAPDAPDWLDAEALAEWRRVAPTLERLDLLKPEDRALLSAYCETWSVYVAAVQRVRAEGLTITSPKSGVVHRNPAVTVAETARMHLLRLASEFGLTPAAEQRLAVAPGDDGDGLNPFAPDR
Bibliography
No article yet recorded