Gene Mb1605c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable phiRv1 phage protein |
| Comments | Mb1605c, -, len: 104 aa. Equivalent to Rv1579c,len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 104 aa overlap). Probable phiRv1 phage protein (see citation below). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1768675 | 1768989 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1605c|Mb1605c
MTPINRPLTNDERQLMHELAVQVVCSQTGCSPDAAVEALESFAKDGTLILRGDTENAYLEAGGNVLVHADRDWLAFHASYPGNDPLRDARPIEQDDDQGAGSPS
Bibliography
No article yet recorded