Gene Mb1606c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable phiRv1 phage protein |
| Comments | Mb1606c, -, len: 90 aa. Equivalent to Rv1580c, len: 90 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 90 aa overlap). Probable phiRv1 phage protein (see citation below). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1768986 | 1769258 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1606c|Mb1606c
MAETPDHAELRRRIADMAFNADVGMATCKRCGDAVPYIILPNLQTGEPVMGVADNKWKRANCPVDVGKPCPFLIAEGVADSTDDTIEVDQ
Bibliography
No article yet recorded