Gene Mb1610c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible phiRv1 phage protein |
| Comments | Mb1610c, -, len: 73 aa. Equivalent to Rv1584c, len: 73 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 73 aa overlap). Possible phiRv1 phage protein (putative excisionase) (see citation below). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1771673 | 1771894 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1610c|Mb1610c
MSTIYHHRGRVAALSRSRASDDPEFIAAKTDLVAANIADYLIRTLAAAPPLTDEQRTRLAELLRPVRRSGGAR
Bibliography
No article yet recorded