Gene Mb1611c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible phage phiRv1 protein |
| Comments | Mb1611c, -, len: 171 aa. Equivalent to Rv1585c,len: 171 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 171 aa overlap). Possible phage phiRv1 protein (see citation below). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1771950 | 1772465 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1611c|Mb1611c
MSRHHNIVIVCDHGRKGDGRIEHERCDLVAPIIWVDETQGWLPQAPAVATLLDDDNQPRAVIGLPPNESRLRPEMRRDGWVRLHWEFACLRYGAAGVRTCEQRPVRVRNGDLQTLCENVPRLLTGLAGNPDYAPGFAVQSDAVVVAMWLWRTLCESDTPNKLRATPTRGSC
Bibliography
No article yet recorded