Gene Mb1624c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1624c, -, len: 136 aa. Equivalent to Rv1598c,len: 136 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 136 aa overlap). Conserved hypothetical protein, some similarity to O06389|Rv0523c|MTCY25D10.02 from Mycobacterium tuberculosis (131 aa), FASTA scores: E(): 2.2e-09, (38.4% identity in 99 aa overlap); and P95144|MTCY359.02|Rv1871c (129 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1784439 | 1784849 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1624c|Mb1624c
MSAKDHPNNAPGVPMVFPLWLERLQVKYINRALKPIARYLPGTATIEHRGRKSGKPYQTIVTAYRKDGVLAIALAHGKTDWVKNVLAAGEADVHFARGVVHVINPRIVPAGSDGQGLPRMARLQLRRIGVFVGDIA
Bibliography
No article yet recorded