Gene Mb1627
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable imidazole glycerol-phosphate dehydratase hisB |
| Comments | Mb1627, hisB, len: 210 aa. Equivalent to Rv1601,len: 210 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 210 aa overlap). Probable hisB,imidazole glycerol-phosphate dehydratase (EC 4.2.1.19). Similar to many e.g. HIS7_STRCO|P16247 from Streptomyces coelicolor (197 aa),FASTA results: opt: 763, E(): 0,(57.4% identity in 202 aa overlap). BELONGS TO THE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1787401 | 1788033 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1627|hisB
MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL
Bibliography
No article yet recorded