Gene Mb1634c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable peroxidoxin bcpB |
Comments | Mb1634c, bcpB, len: 154 aa. Equivalent to Rv1608c,len: 154 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 154 aa overlap). Probable bcpB,peroxidoxin or bacterioferritin comigratory protein,similar to many, e.g. AE0003|ECAE000335_4 bacterioferritin comigratory protein from Escherichia coli K-12 MG1655 (156 aa), FASTA scores: opt: 329, E(): 1.2e-16, (38.2% identity in 152 aa overlap); Z97179|MLCL383_22 Mycobacterium leprae cosmid L383 (161 aa) (40.2% identity in 132 aa overlap). Also similar to Rv2428 AhpC, alkyl hydroperoxide reductase from Mycobacterium tuberculosis; and other Mycobacterium tuberculosis putative peroxidoxins Rv2521, Rv2238c,Rv1932. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1792664 | 1793128 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1634c|bcpB MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVRKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRSG
Bibliography
No article yet recorded