Gene Mb1650c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved membrane protein |
| Comments | Mb1650c, -, len: 195 aa. Equivalent to Rv1624c,len: 195 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 195 aa overlap). Probable membrane protein, first start taken. Some similarity to Rv3155 nuoK, NADH dehydrogenase chain K from Mycobacterium tuberculosis. Also similar to AAK72093.1|AF196488 hypothetical protein from Mycobacterium smegmatis (205 aa). Identities = 117/195 (60%). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1811364 | 1811951 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1650c|Mb1650c
MCHTAPMEPSPVVSPLPRLLPHLWKSTLASGILSLILGVLVLAWPGISILVAAMAFGVYLLITGVAQVAFAFSLHVSAGGRILLFISGAASLILAVLAFRHFGDAVLLLAIWIGIGFIFRGVATTVSAISDPMLPGRGWSIFVGVISLIAGIVVMASPFESIWILALVVGIWLVVIGACEIASSFAIRKASQTLG
Bibliography
No article yet recorded