Gene Mb1652
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable two-component system transcriptional regulator |
Comments | Mb1652, -, len: 205 aa. Equivalent to Rv1626, len: 205 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 205 aa overlap). Probable two-component response system transcriptional regulator, similar to many e.g. CHEY_BACSU|P24072 chemotaxis protein chey homolog (119 aa), FASTA scores: opt: 283, E(): 1.6e-16, (43.0% identity in 114 aa overlap). Also similar to AL109732|SC7H2_27 hypothetical protein from Streptomyces coelicolor (218 aa), opt: 880, E(): 0, (69.4% identity in 196 aa overlap). |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1813546 | 1814163 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1652|Mb1652 MTGPTTDADAAVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLGTPKDT
Bibliography
No article yet recorded