Gene Mb1670
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50S ribosomal protein L20 rplT |
| Comments | Mb1670, rplT, len: 129 aa. Equivalent to Rv1643,len: 129 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 129 aa overlap). rplT, 50S ribosomal protein L20, similar to several e.g. RL20_ECOLI|P02421 from Escherichia coli (117 aa), FASTA scores: opt: 438,E(): 5.8e-24, (60.3% identity in 116 aa overlap). Contains PS00937 Ribosomal protein L20 signature. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1838549 | 1838938 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1670|rplT
MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKLWIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPEDVNAPSGEAA
Bibliography
No article yet recorded