Gene Mb1688
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | chalcone synthase pks10 |
| Comments | Mb1688, pks10, len: 353 aa. Equivalent to Rv1660,len: 353 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 353 aa overlap). Possible pks10,chalcone synthase (EC 2.3.1.74), similar to BCSA_BACSU|P54157 putative chalcone synthase from B. subtilis (365 aa), FASTA scores: opt: 701, E(): 0, (33.1% identity in 362 aa overlap). Also similar to M. tuberculosis Rv1665|pks11 polyketide synthase (chalcone synthase); and Rv1372|pks18 polyketide synthase. Other upstream initiation sites are possible but homology suggests this start. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1859546 | 1860607 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1688|pks10
MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEGYEDIVRQLHASAKVNSRHLVLPLEKYPKLTDFGEANKIFIEKAVDLGVQALAGALDESGLRPEDLDVLITATVTGLAVPSLDARIAGRLGLRADVRRVPLFGLGCVAGAAGVARLHDYLRGAPDGVAALVSVELCSLTYPGYKPTLPGLVGSALFADGAAAVVAAGVKRAQDIGADGPDILDSRSHLYPDSLRTMGYDVGSAGFELVLSRDLAAVVEQYLGNDVTTFLASHGLSTTDVGAWVTHPGGPKIINAITETLDLSPQALELTWRSLGEIGNLSSASVLHVLRDTIAKPPPSGSPGLMIAMGPGFCSELVLLRWH
Bibliography
No article yet recorded