Gene Mb1698
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable membrane protein |
| Comments | Mb1698, -, len: 130 aa. Equivalent to Rv1671, len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 130 aa overlap). Probable membrane protein. Weak similarity to mercuric transport proteins. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1881871 | 1882263 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1698|Mb1698
MPTVGPADHAAGLDRRATPDQLPIWRIGIISGLVGMLCCVGPTILALVGIISAATAFAWANDLYDNYAWWFRVSGLAVLAILVWWALRHRNRCSVNAIRRLRWRLMAVLAIAVGTYGVLSAVTTWFGTFV
Bibliography
No article yet recorded