Gene Mb1698 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | probable membrane protein | 
| Comments | Mb1698, -, len: 130 aa. Equivalent to Rv1671, len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 130 aa overlap). Probable membrane protein. Weak similarity to mercuric transport proteins. | 
| Functional category | Cell wall and cell processes | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1881871 | 1882263 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1698|Mb1698
MPTVGPADHAAGLDRRATPDQLPIWRIGIISGLVGMLCCVGPTILALVGIISAATAFAWANDLYDNYAWWFRVSGLAVLAILVWWALRHRNRCSVNAIRRLRWRLMAVLAIAVGTYGVLSAVTTWFGTFV
      
    Bibliography
    No article yet recorded