Gene Mb1749c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc12 |
| Comments | Mb1749c, -, len: 129 aa. Equivalent to Rv1720c,len: 129 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 129 aa overlap). Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. O53610|Rv0065|MTV030.08 (133 aa), FASTA scores: E(): 1.5e-10, (39.1% identity in 128 aa overlap); P71550|Rv0960|MTCY10D7.14C (129 aa) and O06415|Rv0549c|MTCY25D10.28C (137 aa). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1932370 | 1932759 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1749c|vapc12
MIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFTQRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Bibliography
No article yet recorded