Gene Mb1750c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb12 |
| Comments | Mb1750c, -, len: 75 aa. Equivalent to Rv1721c, len: 75 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 75 aa overlap). Conserved hypothetical protein, similar to Rv0300|MTCY63.05|O07227 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (73 aa). Start changed since original submission. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1932756 | 1932983 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1750c|vapb12
MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLGASAAELVDEARSE
Bibliography
No article yet recorded