Gene Mb1767
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1767, -, len: 94 aa. Equivalent to Rv1738, len: 94 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 94 aa overlap). Conserved hypothetical protein, similar to P71931|Rv2632c|YQ32_MYCTU Hypothetical 10.1 kd protein from Mycobacterium tuberculosis (93 aa),FASTA scores: opt: 319, E(): 2.6e-27, (53.9% identity in 89 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1951054 | 1951338 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1767|Mb1767
MCGDQSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY
Bibliography
No article yet recorded