Gene Mb1769
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb34 |
| Comments | Mb1769, -, len: 70 aa. Equivalent to Rv1740, len: 70 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 70 aa overlap). Conserved hypothetical protein, highly similar to other Mycobacterium tuberculosis hypothetical proteins e.g. P96913|Rv0623|MTCY20H10.04 (84 aa), (73.5% identity in 68 aa overlap); P71998|Rv1740 (70 aa), and O07770|Rv0608 (81 aa). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1953102 | 1953314 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1769|vapb34
MELAARMGETLTQAVVVAVREQLARRTGRTRSISLREELAAIGRRCAALPVLDTRAADTILGYDERGLPA
Bibliography
No article yet recorded