Gene Mb1770
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc34. contains pin domain. |
| Comments | Mb1770, -, len: 82 aa. Equivalent to Rv1741, len: 82 aa, from Mycobacterium tuberculosis strain H37Rv,(98.8% identity in 82 aa overlap). Conserved hypothetical protein, very similar in N-terminus to other M. tuberculosis hypothetical proteins e.g. P96914|Rv0624|MTCY20H10.05 (131 aa), (80.4% identity in 56 aa overlap); P71999|Rv1741 (82 aa) and O07769|Rv0609 (133 aa). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1953314 | 1953562 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1770|vapc34
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVLAG
Bibliography
No article yet recorded