Gene Mb1774c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable isopentenyl-diphosphate delta-isomerase IDI (IPP isomerase) (Isopentenyl pyrophosphate isomerase) |
| Comments | Mb1774c, idi, len: 176 aa. Equivalent to Rv1745c,len: 203 aa, from Mycobacterium tuberculosis strain H37Rv,(99.4% identity in 176 aa overlap). Probable idi,isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2),similar to Q46822|ORF_O182 from Escherichia coli (182 aa),FASTA scores: opt: 465, E(): 4.7e-25, (46.9% identity in 162 aa overlap), and to IPPI_SCHPO|Q10132 isopentenyl-diphosphate delta-isomerase from Schizosaccharomyces pombe (227 aa), FASTA scores: opt: 185, E(): 5.4e-06, (30.3% identity in 152 aa overlap). BELONGS TO THE IPP ISOMERASE TYPE 1 FAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis,truncation at the 3' end due to a single base tranversion (g-t), leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (176 aa versus 203 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1956859 | 1957389 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1774c|idi
MTRSYRPAPPIERVVLLNDRGDATGVADKATVHTGDTPLHLAFSSYVSDLHDQLLITRRAATKRTWPAVWTNSCCGHPLPGESLPGAIRRRLAAELGLTPDRVDLILPGFRYRAAMADGTVENEICPVYRVQVDQQPRPNSDEVDAIRWLSWEQFVRDVTAGVIAPVSPWCRSQLG
Bibliography
No article yet recorded
