Gene Mb1792c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible exported protein |
| Comments | Mb1792c, -, len: 127 aa. Equivalent to Rv1761c,len: 127 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 127 aa overlap). Possibly exported protein with hydrophobic stretch or TMhelix at aa 15-37. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1985510 | 1985893 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1792c|Mb1792c
MSDFDTERVSRAVAAALVGPGGVALVVKVFAGLPGVIHTPARRGFFRSNPERIQIGDWRYEVAHDGRLLAAHMVNGIVIAEDALIAEAVGPHLARALGQIVSRYGATVIPNINAAIEVLGTGTDYRF
Bibliography
No article yet recorded