Gene Mb1796
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1796, -, len: 119 aa. Equivalent to Rv1767, len: 119 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 119 aa overlap). Conserved hypothetical protein, similar to Q57498|YA53_HAEIN HYPOTHETICAL PROTEIN HI1053 from Haemophilus influenzae (113 aa), FASTA scores: opt: 233, E(): 6.4e-10, (40.0% identity in 90 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1990514 | 1990873 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1796|Mb1796
MSDQPRHHQVLDDLLPQHRALRHQIPQVYQRFVALGDAALTDGALSRKVKELVALAIAVVQGCDGCVASHAQAAVRAGATAQEAAEAIGVTILMHGGPATIHGARAYAAFCEFADTTPS
Bibliography
No article yet recorded