Gene Mb1809
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1809, -, len: 187 aa. Equivalent to Rv1780, len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 187 aa overlap). Conserved hypothetical protein, equivalent to Q49881|ML1380|U00021_2 cosmid L247 from Mycobacterium leprae (187 aa), FASTA scores: opt: 1000, E(): 0, (82.4% identity in 187 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2005157 | 2005720 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1809|Mb1809
MQNHDYVTYEEFGRRFFEVAVTPDRVAAAFADIAGSEFAMEPISQGPGGIAKVSANVKIREPRVTRKLGDLITFVIHIPLSIDLLLDLRLDKQRFMVAGDIALRATARAAEPLLLIVDVAKPRPSDITVNVSSKSIRGEVLRILAGVDGEIRRFIAQYVSAEIDSPKSQAAQVINVAEQLDSTWSGP
Bibliography
No article yet recorded