Gene Mb1821
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | putative esat-6 like protein esxn (esat-6 like protein 5) |
Comments | Mb1821, esxN, len: 94 aa. Equivalent to Rv1793,len: 94 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 94 aa overlap). esxN, putative ESAT-6 like protein, conserved hypothetical protein, almost identical to several hypothetical mycobacterial proteins of the ESAT-6-like family including P95242|Rv2346c|MTCY98.15C|Z83860 PUTATIVE ESAT-6 LIKE PROTEIN 6 (94 aa), FASTA scores: opt: 610, E(): 0, (97.9 % identity in 94 aa overlap); Rv3619c, Rv1037c, and Rv1198,etc. Also present in Mycobacterium leprae. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2021149 | 2021433 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1821|esxN MTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
Bibliography
No article yet recorded