Gene Mb1833c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1833c, -, len: 108 aa. Equivalent to Rv1804c,len: 108 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 108 aa overlap). Conserved hypothetical protein, similar to several hypothetical Mycobacterium tuberculosis proteins that may be exported (hydrophobic stretch at N-terminus) e.g. O07222|Rv1810|MTCY16F9.04C|Z96073 (118 aa), FASTA scores: opt: 361, E(): 2.3e-19, (53.5% identity in 101 aa overlap); Rv0622, Rv1690, and Rv3067, etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2037478 | 2037804 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1833c|Mb1833c
MRVVSTLLSIPLMIGLAVPAHAGPSGDDAVFLASLERAGITYSHPDQAIASGKAVCALVESGESGLQVVNELRTRNPGFSMDGCCKFAAISAHVYCPHQITKTSVSAK
Bibliography
No article yet recorded