Gene Mb1840
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1840, -, len: 118 aa. Equivalent to Rv1810, len: 118 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 118 aa overlap). Conserved hypothetical protein, similar to several hypothetical Mycobacterium tuberculosis proteins that may be exported (possible N-terminal signal sequence) e.g. O53953|Rv1804c|MTV049.26c|AL022021 (108 aa), FASTA scores: opt: 361, E(): 9.6e-17, (53.5% identity in 101 aa overlap); Rv0622, and Rv1690, etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2043388 | 2043744 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1840|Mb1840
MQLQRTMGQCRPMRMLVALLLSAATMIGLAAPGKADPTGDDAAFLAALDQAGITYADPGHAITAAKAMCGLCANGVTGLQLVADLRDYNPGLTMDSAAKFAAIASGAYCPEHLEHHPS
Bibliography
No article yet recorded