Gene Mb1858
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein with fha domain, gara |
| Comments | Mb1858, cfp17, len: 162 aa. Equivalent to Rv1827,len: 162 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 162 aa overlap). cfp17, conserved hypothetical protein (see citation below), equivalent to O32919|MLCB1788.36c hypothetical protein from Mycobacterium leprae (162 aa), FASTA scores: opt: 888,E(): 0, (87.0% identity in 161 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2063060 | 2063548 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1858|gara
MTDMNPDIEKDQTSDEVTVETTSVFRADFLSELDAPAQAGTESAVSGVEGLPPGSALLVVKRGPNAGSRFLLDQAITSAGRHPDSDIFLDDVTVSRRHAEFRLENNEFNVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPKQGEDDGSTGGP
Bibliography
No article yet recorded