Gene Mb1877c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional repressor blai |
| Comments | Mb1877c, -, len: 138 aa. Equivalent to Rv1846c,len: 138 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 138 aa overlap). Possible transcriptional regulatory protein. Equivalent to MLCB1788.17|AL008609 hypothetical protein from Mycobacterium leprae (142 aa), FASTA scores: opt: 736 E(): 0, (95.1% identity in 123 aa overlap). Also similar to BLAI_BACLI|P06555 penicillinase repressor (128 aa), fasta scores: opt: 114, E(): 0.12, (23.7% identity in 131 aa overlap). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2086393 | 2086809 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1877c|blai
MAKLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMTVLQRLAKKNLVLQIRDDRAHRYAPVHGRDELVAGLMVDALAQAEYSGSRQAALVHFVERVGADEADALRRALAELEAGHGNRPPAGAATET
Bibliography
No article yet recorded