Gene Mb1902c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1902c, -, len: 129 aa. Equivalent to Rv1871c,len: 129 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 129 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins Q11057|Rv1261|MTCY50.21 (149 aa), FASTA score: opt: 125, E(): 0.019, (32.6% identity in 89 aa overlap); Rv0523c, and Rv1598c. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2111704 | 2112093 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1902c|Mb1902c
MNAAMNLKREFVHRVQRFVVNPIGRQLPMTMLETIGRKTGQPRRTAVGGRVVDNQFWMVSEHGEHSDYVYNIKANPAVRVRIGGRWRSGTAYLLPDDDPRQRLRGLPRLNSAGVRAMGTDLLTIRVDLD
Bibliography
No article yet recorded