Gene Mb1929
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE DEHYDROGENASE [SECOND PART] |
| Comments | Mb1929, -, len: 234 aa. Equivalent to middle part of Rv1895, len: 384 aa, from Mycobacterium tuberculosis strain H37Rv, (97.9% identity in 234 aa overlap). Possible dehydrogenase (EC 1.1.-.-), similar to various sorbitol and alcohol dehydrogenases, and to putative glutathione-dependent aldehyde dehydrogenase e.g DHSO_BACSU|Q06004 Sorbitol dehydrogenase (EC 1.1.1.14) from Streptomyces coelicolor (352 aa), FASTA results: opt: 506, E(): 7.2e-24, (30.6% identity in 350 aa overlap); and AL109962|SCJ1.28 PUTATIVE ZINC-CONTAINING DEHYDROGENASE from Streptomyces coelicolor (356 aa), FASTA results: opt: 634, E(): 2.9e-30, (34.7% identity in 357 aa overlap). Also similar to other Mycobacterium tuberculosis dehydrogenases. ****Note that there is a substantial (134 bp) overlap at the C-terminus with the C-terminus of the downstream ORF, although both appear to be true coding regions. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv1895 exists as a single gene. In Mycobacterium bovis, two frameshifts due to a single base deletion (a-*) and a single base insertion (*-t),consecutively, splits Rv1895 into 2 main parts, Mb1928 and Mb1929. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2133076 | 2133780 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1929|Mb1929
MIFGAGVLGGAQADLLAVPAADFQVLKIPEGITTEQALLLTDNLATGWAAAQRADISFGSAVAVIGLGAVGLCALRSAFIHGAATVFAVDRVKGRLQRAATWGATPIPSPAAETILAATRGRGADSVIDAVGTDASMSDALNAVRPGGTVSVVGVHDLQPFPLPALTCLLRSITLRMTMAPVQRTWPELIPLLQSGRLDVDGIFTTTLPLDEAAKGYATARARSGEELKVLLTP
Bibliography
No article yet recorded