Gene Mb1978c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin maze5 |
| Comments | Mb1978c, -, len: 125 aa. Equivalent to Rv1943c,len: 125 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 125 aa overlap). Conserved hypothetical protein, showing some similarity with Rv1946c|MTCY09F9.18|lppG possible conserved lipoprotein from Mycobacterium tuberculosis (150 aa), FASTA score: (71.4% identity in 28 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2186604 | 2186981 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1978c|maze5
MKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDEALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Bibliography
No article yet recorded