Gene Mb1979c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1979c, -, len: 196 aa. Equivalent to Rv1944c,len: 196 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 196 aa overlap). Conserved hypothetical protein, similar to C-terminal part of SCE20.29|AL136058|CAB65585.1 hypothetical protein from Streptomyces coelicolor (338 aa), BLASTP scores,Identities = 37/131 (28%), Positives = 51/131 (38%). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2186978 | 2187568 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1979c|Mb1979c
MISDTEDFAHGDKAAPPRLRASYAACGGDAAGCWTMSDNGASRVPPVDETPAAESAEPITAVSLAWLPAGDYERALDLWPDFAGSDLVTGPDGPVAHPLYCRRMQQKLVEFAEAGFPGLAVAAIRVAPFAAWCAEQGQEPDSPEARAEYAAYLTAHGDHDVMAWPPGRNQQCWCGSGHKYKKCCAAASFIDTEPAP
Bibliography
No article yet recorded