Gene Mb1987
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb14 |
| Comments | Mb1987, -, len: 71 aa. Equivalent to Rv1952, len: 71 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 71 aa overlap). Conserved hypothetical protein. Some similarity to P55510|Y4JJ_RHISN PUTATIVE PLASMID STABILITY PROTEIN (85 aa), FASTA scores: opt: 127,E(): 0.00096, (42.5% identity in 73 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2192360 | 2192575 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1987|vapb14
MIRNLPEGTKAALRVRAARHHHSVEAEARAILTAGLLGEEVPMPVLLAADSGHDIDFEPERLGLIARTPQL
Bibliography
No article yet recorded