Gene Mb1995c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin pard1 |
| Comments | Mb1995c, -, len: 83 aa. Equivalent to Rv1960c, len: 83 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 83 aa overlap). Conserved hypothetical protein, similar to O85269|AF102990|AF102990_51 hypothetical protein of Yersinia enterocolitica (80 aa),FASTA scores: opt: 149, E(): 0.00037, (42 .1% identity in 57 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2195608 | 2195859 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1995c|pard1
MGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADASRGR
Bibliography
No article yet recorded