Gene Mb2004c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc36. contains pin domain. |
| Comments | Mb2004c, -, len: 139 aa. Equivalent to Rv1982c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 139 aa overlap). Conserved hypothetical protein. BELONGS TO THE UPF0110 FAMILY. Similar to Rv0624|Z92772|MTY20H10.05 from Mycobacterium tuberculosis (131 aa), FASTA scores: opt: 288, E(): 4.1e-14, (40.2% identity in 127 aa overlap); also similar to Rv0624, Rv2759c, and Rv0609 |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2204329 | 2204748 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2004c|vapc36
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAATQRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Bibliography
No article yet recorded