Gene Mb2016c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2016c, -, len: 90 aa. Equivalent to Rv1993c, len: 90 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 90 aa overlap). Conserved hypothetical protein, very similar to Rv3269|Z92771|MTCY71.09 hypothetical protein from Mycobacterium tuberculosis (93 aa), FASTA results: opt: 309, E(): 3.2e-16, (63.3% identity in 79 aa overlap). Also similar to Rv0968 (98 aa) (51.1% identity in 94 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2216219 | 2216491 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2016c|Mb2016c
MVTHELLVKAAGAVLTGLVGVSAYETLRKALGTAPIRRASVTVMEWGLRGTRRAEAAAESARLTVADVVAEARGRIGEEAPLPAGARVDE
Bibliography
No article yet recorded