Gene Mb2028c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | universal stress protein family protein |
Comments | Mb2028c, -, len: 295 aa. Equivalent to Rv2005c,len: 295 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 295 aa overlap). Conserved hypothetical protein, similar to MTCY39.23c, (50.3% identity in 316 aa overlap), C-terminus shows some similarity with YXIE_BACSU P42297 hypothetical 15.9 kd protein in bglh- (148 aa), FASTA scores, opt: 124, E(): 0.038, (28.5% identity in 144 aa overlap), also similar to Rv2623 (294 aa), (52.7% identity in 296 aa overlap) and other Mycobacterium tuberculosis hypothetical proteins e.g. Rv1996, Rv2624c, Rv2028c, Rv3134c, Rv1636. Some,possibly all, of these belong to universal stress protein family. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2229912 | 2230799 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2028c|Mb2028c MSKPRKQHGVVVGVDGSLESDAAACWGATDAAMRNIPLTVVHVVNADVATWPPMPYPETWGVWQEDEGRQIVANAVKLAKEAVGADRKLSVKSELVFSTPVPTMVEISNEAEMVVLGSSGRGALARGLLGSVSSSLVRRAGCPVAVIHSDDAVIPDPQHAPVLVGIDGSPVSELATAVAFDEASRRGVELIAVHAWSDVEVVELPGLDFSAVQQEAELSLAERLAGWQERYPDVPVSRVVVCDRPARKLVQKSASAQLVVVGSHGRGGLTGMLLGSVSNAVLHAARVPVIVARQS
Bibliography
No article yet recorded