Gene Mb2030c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ferredoxin fdxa |
| Comments | Mb2030c, fdxA, len: 114 aa. Equivalent to Rv2007c,len: 114 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 114 aa overlap). Probable fdxA,ferredoxin, similar to e.g. FER_MYCSM P00215 ferredoxin,Mycobacterium smegmatis (106 aa), FASTA scores, opt: 448,E(): 1 .6e-21, (58.7% identity in 109 aa overlap), also similar to Rv0886|MTCY31.14, (34.2% identity in 117 aa overlap) and fdxC|Rv1177. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2235000 | 2235344 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2030c|fdxA
MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPACRVEAIYWEGDLPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIGVDTPLVAAIPVECP
Bibliography
No article yet recorded